Protein Info for Atu4432 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 116 to 141 (26 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 29 to 120 (92 residues), 37.1 bits, see alignment E=3.2e-13 PF00528: BPD_transp_1" amino acids 132 to 353 (222 residues), 141.2 bits, see alignment E=3.2e-45

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4432)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGM9 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Atu4432 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MSIVEANSRARQGKRRANARAKAIIGFALTVITTFLGLMAVTFFIGRVVPIDPALAIVGD
RAPAHVVERVREQLGLNLPLWQQFFLYLKQALSGDFGISVLTTNPVMEDIKRVFPATIEL
ATIGTIIGAVFGIPLGVLAAVKRGSFADQVVRVIGLIGYSVPIFWLGLLALLVFYARLQW
VAYPGRMDIVYEFTFTPVTGFFLIDAIWQRQWDVLWDLFRHIILPASLLGYFSLAYISRM
TRSFMLNELSQEYIVAARAKGLSETRIIWLHALRNAAVPLVTVIALSYAGLLEGSVLTET
IFAWPGLGLYITNSLQNADMNAVLGGTIVIGAIFVGINLFSDLLYRTLDPRTRSR