Protein Info for Atu4428 in Agrobacterium fabrum C58

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR01891: amidohydrolase" amino acids 27 to 386 (360 residues), 330.1 bits, see alignment E=9.1e-103 PF01546: Peptidase_M20" amino acids 86 to 398 (313 residues), 153.8 bits, see alignment E=6.1e-49 PF07687: M20_dimer" amino acids 197 to 291 (95 residues), 33.8 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 100% identity to atu:Atu4428)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGM5 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Atu4428 amidohydrolase (Agrobacterium fabrum C58)
MTRVFPIFKDKLPMRLLDRIGEDLPFLTELRHDLHAHPELGFEEERTSAIVADLLERAGL
KVHRGLGGTGVVGTLQVGNGTRSIGLRADMDALAMPEMPERPYKSKFPGKMHACGHDGHT
AMLLGAARYLAKTRDFSGTVHFIFQPAEEGRGGAKKMVEDGLFDLFPCDAVYGLHNMPGL
GLDEMAVVEGPQLASSDSWRVTFKGIGTHGAKPHLGRDPITATGTFLASLQTIVGRVIDP
LQPAVVSACSVQAGDPKALNVIPDLVEIGGTARAYAADVRDQLEAEIGRLAKGTAAMFGI
EAQYDFIRRIPPVINEADATKRALRAAKTVFGTKARTAFPPSTAGDDFAFFAGEAPGCYV
WLGNGPAVDGALHHNTSYDFNDAAIVPGVAFWATLVEQELAAE