Protein Info for Atu4427 in Agrobacterium fabrum C58

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF06745: ATPase" amino acids 58 to 113 (56 residues), 26.7 bits, see alignment E=3.6e-10 PF03796: DnaB_C" amino acids 58 to 115 (58 residues), 31 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4427)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUX5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Atu4427 replicative DNA helicase (Agrobacterium fabrum C58)
MKLSTPIFQLKRRAKLMVRNNAIPLHEALDQIAREEGFARWSLLSAHVAAGSLSENLFSR
IVHGDMLLLAGRPGQGKTALGFELLRAAAEDGRQSVLLTLEMTEQQARKRIEKHAAGKRE
TEIVTSDEICADYIIRHLSPARPGTFAVIDYLQILDQQRHKPDLSQQVTALGEFAQKTGV
IFAFISQVDRSFDPENKRLPDMRDIRLPNLLDLGLFTKACFLHNGEAQLHNVN