Protein Info for Atu4404 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 329 to 347 (19 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details PF05940: NnrS" amino acids 5 to 386 (382 residues), 261.8 bits, see alignment E=6.4e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4404)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGL1 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Atu4404 hypothetical protein (Agrobacterium fabrum C58)
MRQPPILSEALRLFFPLAALHGAVWPFLWIVIGGYALPFANAVPPSQWHAHEMIFGTYGM
ALAGFLGSAVPEWTDTKAAAGRTLLCLAGLWLPGRLIGFVGADTWSLLAGFFDLAFLLAL
SVLIGKAMLVRRTTKHLAFLVWLILFAAAETGVRYAWWMGDLEFAVRCLEAALCIFIVLF
SLSAARINVVVINLALDPSGETTPYRPHPGRQHMAGAMVTLYMAAKLLFPESDVCAWLAL
AAGAAFFDRLAEWFIGRAVFRTEVLLLALGNAFAGAGFLALGATRLGFSVTSAAGLHLLS
VGALGCAIMAVFIIAGLRHTGRDLKHLPWQAHAAAALMVMAGLTRILPEFDVAAVLSPYH
HGLSAILWAASFGIWLQGFLPFMRAPGTDEAGACG