Protein Info for Atu4389 in Agrobacterium fabrum C58

Annotation: nitric oxide reductase, cytochrome c-containing subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13442: Cytochrome_CBB3
  • amino acids 50 to 133 (84 residues), 30.9 bits, E=2.8e-11
• PF00034: Cytochrom_C
  • amino acids 50 to 136 (87 residues), 52.3 bits, E=1.2e-17

Best Hits

Swiss-Prot: 62% identical to NORC_HALHD: Nitric oxide reductase subunit C (norC) from Halomonas halodenitrificans

KEGG orthology group: K02305, nitric oxide reductase, cytochrome c-containing subunit II (inferred from 100% identity to atu:Atu4389)

MetaCyc: 72% identical to nitric oxide reductase cytochrome c subunit (Nitrosomonas europaea)
NITRIC-OXIDE-REDUCTASE-RXN [EC: 1.7.2.5]

Predicted SEED Role

"Nitric-oxide reductase subunit C (EC 1.7.99.7)" in subsystem Denitrification (EC 1.7.99.7)

MetaCyc Pathways

• nitrate reduction I (denitrification) (2/5 steps found)
• nitrifier denitrification (2/6 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.5, 1.7.99.7

Use Curated BLAST to search for 1.7.2.5 or 1.7.99.7

Sequence Analysis Tools

See Q7CUT9 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Atu4389 nitric oxide reductase, cytochrome c-containing subunit (Agrobacterium fabrum C58)
MAERLTKTGARNVFYGGSIFFFAIFVGLTAHSHYYMRTTSTDESTLTESVARGKHVWEKN
SCINCHTLLGEGAYFAPELGNVWKRYGGVEDKETARDSIKAWMAAQPTGIEGRRQMPQFN
LTEQELDDLVDFLEWTSRIKTQNWPPNEAG