Protein Info for Atu4383 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 256 to 273 (18 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 374 to 398 (25 residues), see Phobius details PF05940: NnrS" amino acids 30 to 405 (376 residues), 393.7 bits, see alignment E=5.3e-122

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to atu:Atu4383)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGJ4 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Atu4383 hypothetical protein (Agrobacterium fabrum C58)
MSGSETVLPLGRSRPKGGIPRGLARTGPVIFSYGFRPFFLGGALWAIVAMVLWIAALSGF
IDIGGDYGAPNWHAHEMLFGFASAVLAGFLLTAVPNWTGRLPVSGKPLVWLFALWCAGRL
LLLVPDQVGVVTAAAVDGLFLPALLAICAREVIAGRKWKDLKVLGGLLALSVANIVFHVA
AIGGDHSQMATRLAVSAYTVLVIIVGGRIVPSFTRNWLNRFGRTDFPVPYNGFDTAAILT
GIVALAVWTIEPESMLAVSTALLAAFMHAVRLIRWRGWTTRPEQVLVVLHVAYAFIPVGF
IAIALAALDVMDTRSVLHIFTVGVIGCMMLAVMTRASLGHTGRKLAASRLTIAAYVSLIA
CALLRPAAEFLPGVMMHLYGCSALLWIVGFGLFCVEYGPILMRERKPLKA