Protein Info for Atu4382 in Agrobacterium fabrum C58

Annotation: nitrite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details TIGR02376: nitrite reductase, copper-containing" amino acids 53 to 377 (325 residues), 543.6 bits, see alignment E=8.9e-168 PF07732: Cu-oxidase_3" amino acids 91 to 200 (110 residues), 35.1 bits, see alignment E=1.9e-12 PF07731: Cu-oxidase_2" amino acids 111 to 198 (88 residues), 24.3 bits, see alignment E=3.6e-09 PF00394: Cu-oxidase" amino acids 215 to 366 (152 residues), 62 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 80% identical to NIRK_RHIME: Copper-containing nitrite reductase (nirK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00368, nitrite reductase (NO-forming) [EC: 1.7.2.1] (inferred from 100% identity to atu:Atu4382)

Predicted SEED Role

"Copper-containing nitrite reductase (EC 1.7.2.1)" in subsystem Denitrification (EC 1.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUT2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Atu4382 nitrite reductase (Agrobacterium fabrum C58)
MTETFHITRRNILAGAAFAGAIAPMIIPSAAGAAEEKKAAAKPLTSAEIAALPRAKVDLV
KPPFVHAHTQKAEGGPKIVEFTLTIKEQKMILDDKGTEVHAMTFNGSVPGPLMVVHQDDY
VELTLINPDTNELQHNIDFHSATGALGGGGLTIVNPGEKAILRFKATKAGVFVYHCAPPG
MVPWHVTSGMNGAIMVLPREGLTDGHGKELVYDKVYYVGEQDFYIPRDENGNFKKYESAG
DAMADTLEVMRKLTPSHIVFNGAVGALTGEHALQAAVGEKVLIVHSQANRDTRPHLIGGH
GDYVWATGKFRNPPDLDQETWFIPGGTAGAAFYTFEQPGIYAYVNHNLIEAFELGAAAHF
KVTGEWNNTLMQAVLAPSSI