Protein Info for Atu4380 in Agrobacterium fabrum C58

Annotation: Crp family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00027: cNMP_binding" amino acids 34 to 119 (86 residues), 62.5 bits, see alignment E=4.5e-21 PF13545: HTH_Crp_2" amino acids 152 to 225 (74 residues), 64.1 bits, see alignment E=1.3e-21 PF00325: Crp" amino acids 177 to 206 (30 residues), 27 bits, see alignment 4.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4380)

Predicted SEED Role

"Nitric oxide -responding transcriptional regulator NnrA (Crp/Fnr family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUT0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Atu4380 Crp family transcriptional regulator (Agrobacterium fabrum C58)
MKIDRSVIRSLALFAKMADDELDGLLTHATSRLVPPGEAIFEQGQSAAHFFLLIHGRLKV
TQVTHDGQQIIVRMVHPGDLFGFARALQRSDYPGTATTAAESVILSWQTDLWPQFVEQNP
HLAVSAMQTIGQRLEEAHTRIREMSTQEVERRVAHAVLRLSQQAGRKELDGIRIDFPISR
QDIAEMTGTTLHTVSRILSSWESKGLVQGGRQKLLVCNLPGLAQLAEGETSQV