Protein Info for Atu4372 in Agrobacterium fabrum C58

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 250 to 290 (41 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 310 (268 residues), 108.6 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu4372)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGI6 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Atu4372 ribose ABC transporter permease (Agrobacterium fabrum C58)
MTNPGLQLKTIITDPLTIAIGASAFLLLVGELLSPGFAQGSQIVRLLTIAAILGIVAAGQ
NLVILGGREGIDLSVGAMISLGAVLAGNMMNGQNAGIPLAILVAGGIPFLIGLINGLGIT
FVRIPPLVMTLGMTAVIQGGLVVYSQGVPSGAAAPLLAGFINRPLIFGIPGVLFVWLGIA
AIMLFVLRRTAFGFAIYAIGSNERAATLVGLPVPLIRTLLYGLSGLFAGLTGVCVIGYTG
TSFISVGDQYVLPSIIAVVIGGTSLAGGAGGYVGTMAGAVALTILQSVLITLNLDVWARQ
IIFGVTLLALMLLYGRQKQLRV