Protein Info for Atu4371 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 312 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 304 (262 residues), 84.9 bits, see alignment E=2.7e-28

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu4371)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGI5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu4371 sugar ABC transporter permease (Agrobacterium fabrum C58)
MNSQGVLRRQPWIITLVVLAVLVAVNTFLQPSFVQPSVLQSNLTTFLPLILVAIGQTYVI
LAGDIDLSVGSIVALANVVTVSVVAALGGTTGAVFAGMAAGAAVGLLCGLVNGLFISGLR
FQPIVTTFATGIIFAGLAIWVLPQAGLPVPEAYWQTYSGSFVGLPFVLWVLIGGIAFTLI
VSRIPFHTHLLAVGGNRTGAFQTGLRLSGIRIGAYMISGLFSALAALCLTGETASGDPLL
GASLALSSISAVVLGGTALSGGFGSSTGSIAGALVLGMIGNVIFFAGLPFEYQTLVQGLI
VLTALAGGVLVTRR