Protein Info for Atu4360 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 76 to 102 (27 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 164 to 189 (26 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 290 (199 residues), 60 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 30% identical to Y3749_BRUSU: Probable ABC transporter permease protein BRA0749/BS1330_II0742 (BRA0749) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4360)

Predicted SEED Role

"CELL PROCESSES; Transport of small molecules; carbohydrates, organic acids, alcohols"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGH9 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu4360 sugar ABC transporter permease (Agrobacterium fabrum C58)
MKKLFSSVNDGRGFDIVLVALPLGFLFVMAGLPLIYNIVMSFQEVDMFSLGTFVRPFVGF
KNYVDLFRQPETLPILMNTVTFVVASIAGQFAIGFGLALFFWVNFPGATWLRGLFLVSWV
MPGLVVGAIWNWILSGDFGVLNFFLRESGLISGNIFWRSDANFSLWAVVIANIWLGTSFN
MILLSVGLASIPGDLYEAAELDGASAWQRFYTITLPMMRSTIGAIVSLGLIFTLQQFDLF
AAITDGGPNNSSNVAQYWAWDLSFRQYDFAKGATISVIMIVFVMLASIVYVRSTRHEVRG