Protein Info for Atu4344 in Agrobacterium fabrum C58

Annotation: ATP-dependent Clp protease, ATP-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 13 to 850 (838 residues), 1145.1 bits, see alignment E=0 PF02861: Clp_N" amino acids 24 to 73 (50 residues), 27.1 bits, see alignment 2.1e-09 PF13191: AAA_16" amino acids 200 to 301 (102 residues), 33 bits, see alignment E=4.9e-11 PF00004: AAA" amino acids 223 to 353 (131 residues), 42.5 bits, see alignment E=4.8e-14 amino acids 599 to 725 (127 residues), 28.9 bits, see alignment E=8e-10 PF17871: AAA_lid_9" amino acids 363 to 462 (100 residues), 96.2 bits, see alignment E=5.5e-31 PF07724: AAA_2" amino acids 594 to 758 (165 residues), 170 bits, see alignment E=2.6e-53 PF07728: AAA_5" amino acids 598 to 724 (127 residues), 40.2 bits, see alignment E=1.9e-13 PF10431: ClpB_D2-small" amino acids 766 to 840 (75 residues), 42.5 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to atu:Atu4344)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUP5 at UniProt or InterPro

Protein Sequence (892 amino acids)

>Atu4344 ATP-dependent Clp protease, ATP-binding subunit (Agrobacterium fabrum C58)
MSHIDLNRLVGALEPDLRVTLEAAASVAVRMGHRYVDIPHWLLAVVDAGIYAETFDELKI
PLPVLKAEIGRSLEEAIIGDGEALSLSQNILTAAREAWILASLEAGRDRVTLCDLLLAMD
EETSLRSFVRSAFPSLKAMDRGALERLRSSAENGAGVDVPSALTSSGEAGSAQAAGQNDF
LRLYTHDMTTDARNGKVDPVIGRDDELRQLVDILTRRRQNNPILVGEAGVGKTAVAEALA
LEIASGNVPEKLRNVCLLNLDISLLQAGAGVKGEFERRLHGVIDAVKRSAEPVILFIDEA
HGLVGAGGAAGQGDAANILKPALARGEVRTVAATTWSEYKKYFEKDAALTRRFQPVHVRE
PDEATAIRMLRGVADTFVSHHNVTVRDEAIVAAVQLSARYMPARQLPDKAVSLLDTAAAA
VSLARQTLPERLRAMESERHLLSDELNWLLREPQDEDMQNRIQSIRDELERLEAGIDDLR
GRYDAEMAELAALSEEQPAETGASNVSHLRPATEMRPANAERLVPTVVDREAIAAVVSRW
TGIPLGKLLADQIESARTLDVRMRQRVVGQDAAITRIADAMRTARAGLSDPRRPPAVFFL
VGMSGTGKTETALSLADLLYGGNSHLTTINMSEFKEEHKVSLLLGSPPGYVGFGEGGVLT
EAVRRRPFGVLLLDEIDKAHPGVQDIFYQVFDKGVLRDGEGRDVDFKNTTIFMTANTGSE
LLSALSADPDTMPEGEALEALLMPELTKQFKPAFLGRTIILPFMPLGAEELASVVDMQIG
KIRDRVLATYGTDLRLSDAARDALVARAGASEIGARAIEIMIGKDLLPPLSSFFLEKVIA
GERVGKIVVDFGENGFGIRAEAAGEADEFAVTEEVGVDKVAASDGATRRMRH