Protein Info for Atu4335 in Agrobacterium fabrum C58

Annotation: forkhead-type phosphopeptide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF00498: FHA" amino acids 28 to 93 (66 residues), 60.2 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: K11894, type VI secretion system protein ImpI (inferred from 100% identity to atu:Atu4335)

Predicted SEED Role

"Uncharacterized protein ImpI/VasC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGG1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Atu4335 forkhead-type phosphopeptide-binding protein (Agrobacterium fabrum C58)
MKLALKNTRNIGTGKAGQWSFERGRRAIGRSRDCDWQIDDNERRVSKLHCTLSRDGEGFI
ILDQSANGTLVDGRLLLEGESARLRDGSQINIGGQIFEVAISGNAELDFSDPDASLKMSD
ETLTISAILADIAPNGRSAGGLLGNTAAADDWPETRRESAGRKAKSISRNVEIGWSEPPS
AQGIGTVLPDDWDTEPAASSDHEHTDALNTPVMISRPVSASHDRDFDSVFPDTDEDPIRQ
GRLPADTATAQEIGDLLTALERESADCLAILDIESDHAGQGPAPSLSERMETLIGQQRRL
AASLETLMHGCTQKLEPRLLEAAVDAGNDFRAKIGRRDWQGLVMKTDYWSAYKKQFEENG
RPLPVRQFLQRAARGEAASARETDATAADAKGVNNHDET