Protein Info for Atu4331 in Agrobacterium fabrum C58

Annotation: serine/threonine phosphoprotein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR03373: type VI secretion-associated protein, BMA_A0400 family" amino acids 19 to 154 (136 residues), 145.2 bits, see alignment E=6.5e-47 PF09867: TagF_N" amino acids 19 to 153 (135 residues), 147.1 bits, see alignment E=3.1e-47 PF00481: PP2C" amino acids 274 to 380 (107 residues), 25.4 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K11890, type VI secretion system protein ImpM (inferred from 100% identity to atu:Atu4331)

Predicted SEED Role

"Protein phosphatase ImpM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUN2 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Atu4331 serine/threonine phosphoprotein phosphatase (Agrobacterium fabrum C58)
MADQASRSTQTAAESDRIGFFGKVPSHGDFISDGLERELIATFDDWMRSGMHACADMFAG
RWTEIFSSSPPIRFIVESGIWGNCAYAGVLVPSADRVGRKYPLAIIAQLNGFRRHPRTLY
LDDTWFMAVEALAETSMTGDFDVSRFNASIKKLRLPKPRDEDDAPEMVRGRAPTSLWWHI
DPVSRRARGLKFDGKPRASDFLRLFSDMTGKGDEDGSRAAPAPATVQEKTKQQIPPVTPA
PAHPAEQPSSVIYSYATHPGTRLSLNADALFVSQTPSLFAIADGQGDTHSAAEAARLATN
ILAETPDAENPEMMAQQIRGKLGTVNSLLLSRQATGADGRPMASVVIASIIAHRLSVLWS
GDARAYLLKNGTMHQLSRDHVVVGMKKQLSQCVGLSQQFRPDIVFDEWGLQDRLLLCSYP
LVQILRERAIAEIVFNTPIKDCANALVQEALIENARENVSAIVIGNRREQG