Protein Info for Atu4329 in Agrobacterium fabrum C58

Annotation: polysaccharide export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF02563: Poly_export" amino acids 3 to 80 (78 residues), 37 bits, see alignment E=4.8e-13 PF10531: SLBB" amino acids 88 to 135 (48 residues), 20.6 bits, see alignment 4.8e-08 amino acids 187 to 214 (28 residues), 15.1 bits, see alignment (E = 2.5e-06) PF22461: SLBB_2" amino acids 172 to 268 (97 residues), 38 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4329)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGF8 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu4329 polysaccharide export protein (Agrobacterium fabrum C58)
MRRGDVIDITVLDTGEDGLFSPTQSKTLNLGRFTVDQSGSVNIPFVGKQRVIDSTPEGLQ
SQVVAGLKGSAVNPQAVVTVVDKPTSAVMLSGAVKTPGKIVLTARQERVLDSLNQAGGPT
VAPGAANVTVVRGSQRASAPLDRIMREDRQNIRLSPDDQIMIDGDAASYTALGAFKSAGE
FQFEAGKLTLAQAVGRAGGLLDDRADARNVYVFRNEIVQVPVARASGAKGPVAMATSMRP
VIYHVNMRDASSIALMQLFQMQKGDVLYASNAPLVDSAKLLTVFQKSVPTAAAPLPGSGN