Protein Info for Atu4326 in Agrobacterium fabrum C58

Annotation: proline/glycine betaine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 30 to 38 (9 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 113 to 113 (1 residues), see Phobius details amino acids 115 to 143 (29 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 251 to 269 (19 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 344 to 368 (25 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 19 to 438 (420 residues), 230.4 bits, see alignment E=6.5e-72 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 24 to 422 (399 residues), 457.2 bits, see alignment E=2.6e-141 PF07690: MFS_1" amino acids 62 to 301 (240 residues), 91.3 bits, see alignment E=9.3e-30 amino acids 290 to 432 (143 residues), 36.7 bits, see alignment E=3.6e-13 PF08946: Osmo_CC" amino acids 445 to 496 (52 residues), 66.4 bits, see alignment 3.3e-22

Best Hits

Swiss-Prot: 68% identical to OUSA_DICD3: Glycine betaine/proline/ectoine/pipecolic acid transporter OusA (ousA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to atu:Atu4326)

MetaCyc: 69% identical to osmolyte:H+ symporter ProP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-29; TRANS-RXN-29A

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGF7 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Atu4326 proline/glycine betaine transporter (Agrobacterium fabrum C58)
MSIDDVTVIDDDKVKKAVTAAALGNAMEWFDFGVYGFVAYAVGKVFFPDAAPAVQTVAAL
ATFSVPFLIRPLGGIFFGAMGDKFGRQKVLSLTIIIMAASTFCIGLIPGYATIGIWAPIL
LLLCKLVQGFSVGGEYTGAAIFVAEYAPDRKRGYLGSWLDFGSIAGFVLGAGLVVLLSSA
MGEAKFLDWGWRIPFFLAAPLGLIGLYLRHAAEETPAFTERLQRAEEEDRQSLKERPMVP
IAEIAREHFRSLAICIGMVLVTNVTYYMLLTYMPTYLSKTLNYSEDHGVLIIIAVMVGML
FVQPAIGLLSDRIGRKPFLAAGSTAILFLSLPAFHLIASGQVVQIFFGLLILAVALNCLI
GIMASTLPALFPARIRYSALAIAFNISIIVAGLTPTVTAWLVEVTENIYMPAYYLMVAAV
FGIVTTFFLKETANRPLYGDTPNASSRKEAKSLLAEQYQHIEKSVEEIDEELAKLEEQKK
ILQTKREGLVGRHPDLT