Protein Info for Atu4321 in Agrobacterium fabrum C58

Annotation: ribose ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF00005: ABC_tran" amino acids 17 to 167 (151 residues), 110.7 bits, see alignment E=8.6e-36 amino acids 272 to 423 (152 residues), 58 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 65% identical to RBSA1_BURTA: Ribose import ATP-binding protein RbsA 1 (rbsA1) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to atu:Atu4321)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUM3 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Atu4321 ribose ABC transporter ATPase (Agrobacterium fabrum C58)
MLELNAIRKSFGKIEVLHGVDLEARAGEVHALLGENGAGKSTLMKILCGILQPSEGTIRI
DGKDRRFANYDEAIAAGVGIVFQEFSLIPYLNAVENMFLAREIRGPLRLLNKGAMRKRAA
EIMGRLAVDVPLDVPVHRLSVAQQQFVEIAKALSLDARILVLDEPTATLTPSETEHLFNV
MRELRRQGVAIIFISHHLDEIFEICDRITVLRDGELIGSCLTSEVDNDRLVEMMVGRRIE
ASFPPKPQIDPSAAKVIEVEELQLKKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLG
AHSASRRKIKLDGVDTRLSGPDDALMRGIGLLPESRKEEGLITSFSILQNISLNNYRKYR
KAHWFLDLKKELEHTTKAMAQVQVKAQGPYARVDTLSGGNQQKIVIARWLNHDMRVLIFD
EPTRGIDVGAKAEIYSLMREFAARGHSIIMISSELPEVIGMSDRVCVFRSGGIVATVEGE
DINSETIMTNATTGRVEHVA