Protein Info for Atu4296 in Agrobacterium fabrum C58

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 265 to 282 (18 residues), see Phobius details PF00890: FAD_binding_2" amino acids 14 to 46 (33 residues), 21 bits, see alignment (E = 5.4e-08) PF00732: GMC_oxred_N" amino acids 86 to 307 (222 residues), 61.7 bits, see alignment E=2.7e-20 PF05199: GMC_oxred_C" amino acids 409 to 498 (90 residues), 60.9 bits, see alignment E=6.4e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4296)

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGE0 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Atu4296 dehydrogenase (Agrobacterium fabrum C58)
MSFSSKGDPGSKPDIVIIGSGVGGSAVALKLAATGAKILIIERGEKLPNEPENADAEAVF
VQNRYRTTDLYRDETGRTYRPGQYYYVGGHTKFYGTAMFRFRDRDFREVEHEDGVSPAWP
VSYAELEPFYAEAERLFGVRGRAGDDPTEPPRSAPYMHAPIPHEPVIGRVAKGFERLGLR
PFHMPSAIDYGPGGLCRRCGTCDAFVCRFDAKGDAETRLLRPALRHPNVSLLTGARVRRL
IADGDGKHIVAVEIERAGEITTIEAPLFVLSAGAINSALILLRSADEKKPNGLANSSGVV
GRYLMNHHLSGLMGLLPFTINDTRFPKTMSLNDFFDGTPGDEAARGNVQMLGNIQGPMIR
AAYPWMPRPLANLLARHSVDFLVMSEDTPKYDSRVKPWGKNGAELIYRPGDREAHQRFVR
HMRSLLRKNGFPVVLGHSFGIEAPSHQCGTVRMGDDPKEAALNALCQTYDHPNLYVVDAG
FFPSSAALNPALTVAAQALRVGDHIRQSRFSSLRAHDILSSENNHAP