Protein Info for Atu4295 in Agrobacterium fabrum C58

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF08501: Shikimate_dh_N" amino acids 21 to 94 (74 residues), 73.6 bits, see alignment E=2e-24 TIGR00507: shikimate dehydrogenase" amino acids 23 to 277 (255 residues), 215.8 bits, see alignment E=3.2e-68 PF01488: Shikimate_DH" amino acids 120 to 198 (79 residues), 34.9 bits, see alignment E=2.4e-12 PF18317: SDH_C" amino acids 248 to 277 (30 residues), 38.4 bits, see alignment (E = 1.2e-13)

Best Hits

Swiss-Prot: 38% identical to AROE_GEOKA: Shikimate dehydrogenase (NADP(+)) (aroE) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 100% identity to atu:Atu4295)

MetaCyc: 53% identical to 5-ketofructose reductase (NADP) monomer (Tatumella morbirosei)
Fructose 5-dehydrogenase (NADP(+)). [EC: 1.1.1.124]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.124 or 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUJ9 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Atu4295 shikimate 5-dehydrogenase (Agrobacterium fabrum C58)
MPHDFLAEITGSFAMPAGENPTVAMIEAAYQHHGLNWRYINLEVSPENLKDAVAGARAMG
WAGFNCSIPHKVAVIQHLDGLGESAEIIGAVNTIVRRGDRLIGENTDGKGFVKALRDVID
PKDKKVVLFGAGGAARAVCVEVALAGAAHITVVNRNRERGETVARLIDEKTPATATFAAW
EDAFAIPEETDIVIHATSVGLYPDIDGLPDIDLKTLRPSMVVADGIHNPPRTRLIRAAEA
AGSKTADGLGMLVNQGVIGIKYWTGVDVDAYVMRQALVDLNL