Protein Info for Atu4289 in Agrobacterium fabrum C58

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 104 to 125 (22 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details PF08240: ADH_N" amino acids 1 to 101 (101 residues), 60.5 bits, see alignment E=1.7e-20 PF00107: ADH_zinc_N" amino acids 142 to 271 (130 residues), 109.1 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 37% identical to ADHX_RAT: Alcohol dehydrogenase class-3 (Adh5) from Rattus norvegicus

KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 100% identity to atu:Atu4289)

MetaCyc: 37% identical to FlhA (Paracoccus denitrificans)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.284

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGD8 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Atu4289 alcohol dehydrogenase (Agrobacterium fabrum C58)
MPMALGHEAAGVVEALGEGVRDLEPGDHVVMVFMPSCGHCLPCAEGRPALCEPGAAANAA
GRLLGGATRLNYHGEVVHHHLGVSAFAEYAVVSRNSLVKIDRDLPFVEAALFGCAVLTGV
GAVVNTARVRTGSTAVVIGLGGVGLAAVLGARAAGASKIVAVDLSQEKLALASELGATAI
VNGRDEDAVEQVRELTSGGADYAFEMAGSIRALENAFRMTKRGGTTVTAGLPPPGAALPL
NVVQLVGEERTLKGSYIGTCVPLRDIPRFIALYRDGRLPVNRLLSGRLKLEDINEGFDRL
HDGSAVRQVIEF