Protein Info for Atu4285 in Agrobacterium fabrum C58

Annotation: S-adenosylmethionine:2-demethylmenaquinone methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03737: RraA-like
  • amino acids 26 to 172 (147 residues), 134.4 bits, E=2e-43

Best Hits

Swiss-Prot: 40% identical to LIGK_SPHSK: 4-carboxy-4-hydroxy-2-oxoadipate aldolase (ligK) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 100% identity to atu:Atu4285)

Predicted SEED Role

"Demethylmenaquinone methyltransferase"

MetaCyc Pathways

• 4-hydroxy-4-methyl-L-glutamate biosynthesis (1/2 steps found)
• gallate degradation II (3/5 steps found)
• gallate degradation I (2/4 steps found)
• methylgallate degradation (3/6 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (4/8 steps found)
• superpathway of vanillin and vanillate degradation (5/10 steps found)
• syringate degradation (4/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• C5-Branched dibasic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.17

Sequence Analysis Tools

See A9CGD5 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Atu4285 S-adenosylmethionine:2-demethylmenaquinone methyltransferase (Agrobacterium fabrum C58)
MIHIKDIAERPSRADIEALAKFSPATIHEAQGRRGALSSRLKPVDYRMKLCGPAFTVRCA
PRDNIMLQLAINYAKPGDIIVVSAGEYEEAGSFGDVLANACLAKGIGGLVTDTGVRDTLQ
LRDLGFPVFSLSVCIKGTVKETIAAVNDSIIVGGETINPGDIVVGDADGLVVVRRAEAQE
AARLSQAREDAEAGFIEAYKQGKSVIEVSNLEPVLKAKGLVVDI