Protein Info for Atu4280 in Agrobacterium fabrum C58

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00106: adh_short" amino acids 7 to 185 (179 residues), 156.3 bits, see alignment E=1.7e-49 PF08659: KR" amino acids 8 to 148 (141 residues), 27.9 bits, see alignment E=5.1e-10 PF01370: Epimerase" amino acids 9 to 132 (124 residues), 42.5 bits, see alignment E=1.3e-14 PF13561: adh_short_C2" amino acids 13 to 213 (201 residues), 110.4 bits, see alignment E=2.8e-35 PF13460: NAD_binding_10" amino acids 13 to 134 (122 residues), 32.7 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 36% identical to YDFG_SHIFL: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Shigella flexneri

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to atu:Atu4280)

MetaCyc: 36% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.276

Use Curated BLAST to search for 1.-.-.- or 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGD0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Atu4280 short-chain dehydrogenase (Agrobacterium fabrum C58)
MPFSDYKTALVTGASSGIGAAVVERLRRENIEVHAIARSADALKELADRTGCVAHVIDVT
DRAAIADLASRVQFDILVNNAGVDRPKKFLEADEADIDLLVDVNLRAVLHICRLIVPGMV
ERDRGHVINISSIAGNYNFGGNSTYHAVKAGVAMLSNQLRIDAFGKRVRVTEICPGRVAT
DIFSHVHGNDPSVRERFIDGFELPKAEDIADAIGFAIAAPVAVNIGHMEITPTLQVMGGL
QTAKPQTAAQEGTKKEQKP