Protein Info for Atu4261 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF13476: AAA_23" amino acids 29 to 68 (40 residues), 27.2 bits, see alignment 1.5e-09 PF00005: ABC_tran" amino acids 35 to 174 (140 residues), 122.5 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 44% identical to Y3423_BRUAB: Putative ATP-binding protein BruAb2_1123 (BruAb2_1123) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to atu:Atu4261)

MetaCyc: 42% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGB7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Atu4261 ABC transporter permease (Agrobacterium fabrum C58)
MSSPVRKLEPVTELKPQPMVAIDDVTMAFGSFVAVQNVNLRVGDGEFLSIVGPTGCGKST
ILNAIAGLLKPAQGKVSIDGTAVQGVQNTIGYLFQQDALLPWKTAFQNVELGLMFRGVAE
DERRAKVTAWLEKVGLKGFGDRFPHQLSGGQRKRVQMAQALITEPKVILMDEPFSALDIH
TRHLMQNELLRLWQEDRRAVVMITHDLEEAIALGDRVVVLAAGPKSRVIESFPVDLERPR
NVAEIKLDPKFMTLYRDIWASLRGEVEKSYASR