Protein Info for Atu4260 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 66 to 90 (25 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 245 (170 residues), 97.3 bits, see alignment E=4.8e-32

Best Hits

Swiss-Prot: 31% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to atu:Atu4260)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUG6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Atu4260 ABC transporter permease (Agrobacterium fabrum C58)
MQAVNVRIIQVALLVVLLGGWQLGVSSGAIDRFFFPAPYDIVKQVIDWVADAGFYKHVGI
TLSETVLGYIIGTGLGVGAGVWLGLSPFVARVLDPFIKAVNAIPRVVLAPIFVLWLGLGL
WSKVALAVTLVFFVTFFNAMQGVREVNPVVLSNTRILGAKRSDLLRHVYFPAAASWILSS
LRTSVGFAVVGAIIGEYLGASAGLGYLIARSEGNFDAVGVFAGIIILAVFVLIIDLILDV
AEKKLITWRPNNGEERPA