Protein Info for Atu4250 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 267 (176 residues), 65.4 bits, see alignment E=3e-22

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4250)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGB1 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Atu4250 sugar ABC transporter permease (Agrobacterium fabrum C58)
MKTELSPRAQTLIYFILCVLLVPFVFPTWWMVTSSVKPVSQIFAFPPDIWPRTFDFSSYS
DVFRIQPFALQYWNSAYIAAIVTIGTMAVASMAGYAFARIRFPFANAIFMVVLVGLLIPS
EVTLVPLFRMFLKWGMINTHWPLILVPIFGAPAVFATFIMRQFFISLPVELEEAAWVDGL
SRFKIFWTIALPLARPALAAVAIFTFLGSWNLYLEPIVFLSSPDKFTLPQALTQFTDAYG
GPMWNIQLAAATMTAIPVLIVFIVAQKQFVEGLAHTGLKG