Protein Info for Atu4225 in Agrobacterium fabrum C58

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 12 to 179 (168 residues), 43.2 bits, see alignment E=5.9e-15 PF12833: HTH_18" amino acids 241 to 320 (80 residues), 80.1 bits, see alignment E=1.9e-26 PF00165: HTH_AraC" amino acids 280 to 319 (40 residues), 36.4 bits, see alignment 6.4e-13

Best Hits

Swiss-Prot: 71% identical to GLXA_RHIME: HTH-type transcriptional regulator GlxA (glxA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4225)

Predicted SEED Role

"HTH-type transcriptional regulator glxA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG91 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu4225 AraC family transcriptional regulator (Agrobacterium fabrum C58)
MTIIEPKNIQRIGFILVPNFALMSYASAAEPLRAANLIAGTDLYDAVPLSFDGEAVRSSS
GIIVSCEALAAAGEKCHTIFVCAGGGPQDWTAAENSYGTLRRLARQGVRIGSISSGAYVL
AAAGLLENRDFTIHWEHAPVLKEAFGHLTPRQARFVFDGDRITCAGGVAPLDMMHAMISQ
RMGAHFARRVSDWYLHTAVAEPGAPQRGSSAERYGTNHPALLTVLEKMETTIESPLDRQT
MAKLAGTSARHLDRLFATHLKSSFLETYRAIRLDHARRLLEQSPLSIAEVAFATGFSSAG
HFSGSFKTRFGQTPNAMRQRFPLN