Protein Info for Atu4219 in Agrobacterium fabrum C58

Annotation: cation efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1036 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details amino acids 429 to 452 (24 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details amino acids 524 to 544 (21 residues), see Phobius details amino acids 858 to 877 (20 residues), see Phobius details amino acids 885 to 905 (21 residues), see Phobius details amino acids 911 to 929 (19 residues), see Phobius details amino acids 960 to 980 (21 residues), see Phobius details amino acids 986 to 1009 (24 residues), see Phobius details PF00873: ACR_tran" amino acids 6 to 1007 (1002 residues), 463.4 bits, see alignment E=1.5e-142 PF03176: MMPL" amino acids 825 to 1011 (187 residues), 26 bits, see alignment E=4.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4219)

Predicted SEED Role

"Cell Processes; Protection responses; drug/analog sensitivity and resistance"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG85 at UniProt or InterPro

Protein Sequence (1036 amino acids)

>Atu4219 cation efflux system protein (Agrobacterium fabrum C58)
MSFNLSALAVRERAVTLFFIVLLAAAGVYAFIKLGRAEDPSFTIKTLTVTSVWPGATARE
MQDLVAEPLEKRIQELTWYDRVETTTRPGYAFLTVTLRDDTPASAVEGEFYQARKKLGDE
ARNLPPGVIGPFVNDEYSDVSFALYALKAKGMAMRELVRQAETIRQDMLHVPGVKKINIL
GEQPEQIFVEFSYSKLATLGISAQDIASALQRRNTVTPAGSIDTQGPQVFIRFDGAYDSV
ESIADTPIVAAGRVLKLSDFAEVRRGYQDPATYLIRHDGEPAIMLGVVMQQGWNGLELGK
ALEERSSTIAQTLPLGVTLAKVSDQAVNIDEAVGEFMLKFAMALGVVLFVSLIALGWRVG
IVVALAVPLTLAVVFLIMLETGRFFDRITLGALILALGLLVDDAIIAIEVMVVKMEEGMD
RIKAAAYAWSHTAAPMLSGTLVTIIGLMPVGFAKSSAGEYAGNIFWVVGFALIVSWIVAV
TFTPYLGVKMLPEIKPVEGGHHAIYNTPNYRRLRSLIEFAVRHKFLTCGLVGVIMAVSVV
GMGSVKQQFFPTSDRPEVLVEVRMPEGASIETTTATVKKLEGWLKEQPETKIATSYIGQG
APRFFFAMAPELPNPAFAKIVALTPDAHAREELKHRLREAIASGLAPEASVRVTQLVFGP
YTPFPVEFRITGPDPDQLYKISDEALSIMRSVPDVRQPNRDWGNRTPVLRFIPDQDRLNL
IGLSPAEAAQQMQLLLSGVPITQVRENIRNVPVIARSAGENRLDPSRLSDFSLMSRSGRP
VPLDQIGHSEIRFEEPIMKRRDRTPVITIRSDINEATQPPEVSQQVFKALQPLIASLPAG
YRIEMGGNIEESLKANTALVKIFPLMVAAMLIVIILQVRSLSTMTMVMLTAPLGLAGAVP
MLLIFNQPFGFNAILGLIGLAGILMRNTLILTEQIKENQAAGLDDYHAVIEATVQRTRPV
ILTALAAVLAFIPLTHSVFWGSMAYTLIGGTAVGTIMILLFLPALYAAWFRIKPPRSEAL
PVAATVEEYQHSLAAE