Protein Info for Atu4218 in Agrobacterium fabrum C58

Annotation: multidrug efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 44 to 360 (317 residues), 201.7 bits, see alignment E=7.3e-64 PF16576: HlyD_D23" amino acids 66 to 267 (202 residues), 33 bits, see alignment E=7.8e-12 PF13533: Biotin_lipoyl_2" amino acids 74 to 109 (36 residues), 24.6 bits, see alignment 3.5e-09 PF13437: HlyD_3" amino acids 180 to 263 (84 residues), 30.1 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4218)

Predicted SEED Role

"Component of multidrug efflux system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUC5 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Atu4218 multidrug efflux protein (Agrobacterium fabrum C58)
MKRKILLSTVAVAALFGVGAAIFLFPSTSKDAEAADPRSLAPLVSVTKVKTPNTASRSFT
GTVAARVQSDLGFRVPGKIVERLVGLGEEVKAGQPLMRIDETDLRLALTAKRNAVVAAQA
TFIQAQADEKRFAVLVKSNAASTQQYERSKATLDTATAQLAAARADATVAENEAAYALLV
ADADGTIVETLAEPGQVVSAGQPVIRLAKAGPREALVWLPENLRPEIGAVALAAVYGRNR
QEKAALRQISNAADPQTRTYETRWVLQGAAATAPLGATVTISVENKDALSHAEVPVGALL
DNGDRTGVWVVDEQSSSVHFQAVKVERIGEDKAVVSSLRAGETVVALGAHLLQDGASVRV
GVEKAEAAN