Protein Info for Atu4209 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 15 to 41 (27 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 284 (197 residues), 53.4 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4209)

Predicted SEED Role

"ABC transporter, membrane spanning protein [sugar]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUB6 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Atu4209 sugar ABC transporter permease (Agrobacterium fabrum C58)
MSNFQIRPHRPARPLFYLAPAIALLVVFFLAPIAINAVIAFTDMGASLRVGEFTMRNFER
IVQRDARIPMVLLTTLIYVTATLFIFNVGLGALLAMTSTAIPDRLGNFFRGLWLLPRMSP
AVLYGILWIWIADPSPSGLLNQITATLGLAPINLRNDFPLFLVILANGIVGASFAMVILT
SAIRSIPSHLANAARVDGASEWGVLRHVVAPALSQPIRFITIYQALSLMTTYEYILLITG
GGPVYDSTPYALYIYRRAFENGAYAYGAALALGLMVIGVAVTLVQWRVTNMRSTFAAPRI
EVL