Protein Info for Atu4202 in Agrobacterium fabrum C58

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF05175: MTS" amino acids 48 to 153 (106 residues), 37 bits, see alignment E=1.1e-12 PF13489: Methyltransf_23" amino acids 50 to 177 (128 residues), 36.6 bits, see alignment E=1.5e-12 PF01209: Ubie_methyltran" amino acids 51 to 164 (114 residues), 20.4 bits, see alignment E=1.1e-07 PF13847: Methyltransf_31" amino acids 52 to 155 (104 residues), 43.6 bits, see alignment E=9.6e-15 PF00891: Methyltransf_2" amino acids 55 to 168 (114 residues), 35.1 bits, see alignment E=3.7e-12 PF13649: Methyltransf_25" amino acids 56 to 150 (95 residues), 66.9 bits, see alignment E=8.5e-22 PF08242: Methyltransf_12" amino acids 57 to 152 (96 residues), 58.1 bits, see alignment E=4.9e-19 PF08241: Methyltransf_11" amino acids 57 to 153 (97 residues), 52.3 bits, see alignment E=3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4202)

Predicted SEED Role

"Methyltransferase type 12"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG78 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Atu4202 methyltransferase (Agrobacterium fabrum C58)
MNRTMSSINVLSLPVFNRDASGYDALRRGLIPCFDAFYGTALDLIDDWRDAEKLRVLDLG
AGTGLFTAMLLTRHPDAQIHLIDASEKMLEQARKRFDGNPAITYAVADMANTELGGPWDL
IISALAIHHLEDIGKKHLFGEIRGALSEGGLFVNVEQVLGHDPEVEARYARTWLQQVRRL
GVAEVEIAKAHERMSHDRCSPLENQLQWMRDTGFCEIDCSFKAWRFAVLSGRR