Protein Info for Atu4193 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details amino acids 294 to 321 (28 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 109 (109 residues), 36.9 bits, see alignment E=3.7e-13 PF00528: BPD_transp_1" amino acids 120 to 326 (207 residues), 104.1 bits, see alignment E=7.6e-34

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4193)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUA0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Atu4193 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MLVFIVKRLLWMIPSLFAVSFLAFVLIQLPPGDYVTTYIATLAASNEVIDQNTAAQLRER
FGLGDPMIIQYLKWIWGIISRGDFGISFEWQQPVSGLIWERMALTLVLAIASLLATWAIA
LPIGVFSAVRKYSIGDYMFTAFSFFGLSIPSFLLALVLMYVAAVEFGADVGGLFSAQFET
APWSIAKMIDLMAHIWLPVAILAISSTASLIRVMRANMLDELPKPYVTTARAKGLSEFRL
LTKYPLRIALNPFISTIAWLLPNLISGSVVVAIVLNLPTAAPLLLQSLMAQDMYLAGAFV
LLICALTLIGSLISDILLALVDPRIRLE