Protein Info for Atu4172 in Agrobacterium fabrum C58

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 TIGR00657: aspartate kinase" amino acids 1 to 421 (421 residues), 420.6 bits, see alignment E=9e-130 PF00696: AA_kinase" amino acids 3 to 237 (235 residues), 158.2 bits, see alignment E=6.1e-50 TIGR00656: aspartate kinase, monofunctional class" amino acids 3 to 421 (419 residues), 416.3 bits, see alignment E=1.4e-128 PF01842: ACT" amino acids 285 to 343 (59 residues), 47.1 bits, see alignment E=3.2e-16 PF22468: ACT_9" amino acids 288 to 343 (56 residues), 45.6 bits, see alignment 9.8e-16 amino acids 362 to 419 (58 residues), 77 bits, see alignment E=1.5e-25 PF13840: ACT_7" amino acids 357 to 418 (62 residues), 55.1 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 53% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to atu:Atu4172)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG68 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Atu4172 aspartate kinase (Agrobacterium fabrum C58)
MARIVMKFGGTSVANLERIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVDWVQNAAKV
AGTNAASFYDAREYDAVVASGEQVTSGLLAITLQSMGINARSWQGWQIPIRTDNAHGAAR
ILEIDGSDIVHRMGEGQVAVVAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIY
TDVDGVYTTDPRIEPKARRMKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSF
EDPDAPGMGDLINPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRVADRPGVSAAIFG
PLAEAHINVDMIVQNISEDGSRTDMTFTVPSGDVAKALRVLDENKGQIGFDVAQNETGLA
KVSVIGIGMRSHAGVAASAFKALAEKNINIKAITTSEIKISILIDGAYAELAVRTLHSAY
GLDKA