Protein Info for Atu4172 in Agrobacterium fabrum C58
Annotation: aspartate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to AK_PSEAE: Aspartokinase (lysC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to atu:Atu4172)Predicted SEED Role
"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- L-lysine biosynthesis I (9/9 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-lysine biosynthesis III (6/7 steps found)
- L-lysine biosynthesis VI (6/7 steps found)
- L-homoserine biosynthesis (3/3 steps found)
- L-lysine biosynthesis II (7/9 steps found)
- dipicolinate biosynthesis (3/4 steps found)
- ectoine biosynthesis (3/5 steps found)
- chorismate biosynthesis II (archaea) (8/12 steps found)
- L-methionine biosynthesis IV (2/4 steps found)
- spermidine biosynthesis II (2/4 steps found)
- norspermidine biosynthesis (3/6 steps found)
- 3-dehydroquinate biosynthesis II (archaea) (3/7 steps found)
- superpathway of polyamine biosynthesis III (3/8 steps found)
- cremeomycin biosynthesis (2/7 steps found)
- grixazone biosynthesis (2/8 steps found)
- platensimycin biosynthesis (6/26 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of plant hormones
- Glycine, serine and threonine metabolism
- Lysine biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.2.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CG68 at UniProt or InterPro
Protein Sequence (425 amino acids)
>Atu4172 aspartate kinase (Agrobacterium fabrum C58) MARIVMKFGGTSVANLERIHNVARHVKREVDAGHEVAVVVSAMSGKTNELVDWVQNAAKV AGTNAASFYDAREYDAVVASGEQVTSGLLAITLQSMGINARSWQGWQIPIRTDNAHGAAR ILEIDGSDIVHRMGEGQVAVVAGFQGIGPDNRIATLGRGGSDTSAVAIAAAVKADRCDIY TDVDGVYTTDPRIEPKARRMKKIAFEEMLEMASLGAKVLQVRSVELAMVHKVRTFVRSSF EDPDAPGMGDLINPPGTLICDEDEIVEQEVVTGIAYAKDEAQISLRRVADRPGVSAAIFG PLAEAHINVDMIVQNISEDGSRTDMTFTVPSGDVAKALRVLDENKGQIGFDVAQNETGLA KVSVIGIGMRSHAGVAASAFKALAEKNINIKAITTSEIKISILIDGAYAELAVRTLHSAY GLDKA