Protein Info for Atu4164 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF07536: HWE_HK" amino acids 382 to 463 (82 residues), 57.8 bits, see alignment E=7.5e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4164)

Predicted SEED Role

"sensor histidine kinase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CU80 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Atu4164 two component sensor kinase (Agrobacterium fabrum C58)
MTAGVFYMPRPGNRLKETISALRRRSANFFPTASIGTYLVVMATVITLPLILFVGYLMLR
LEAEKRDDLQRETIEDVRVVSRNIDRRLQEIATSLNLLSQFPELENGNLAAFQGRVAESL
KREGLYALLATKDGQQRLNTRVPYGQPLGKIPAEANLAKAIESRRITVSDLFFGSTSKEW
VFNITMPLDPELGSAGDALILTQNASDLSRLIPTENLPRHWAVAIIDGTNRVVVSSAQDE
AEVGKPFVNPAILSEMQAFSGNFFDGKGNLYAYAQLPGWQWKTVMWGPLAASQAALIDTW
RQMMIGSLVLVLIAIGGAYLVGRQLRSSIRDLTHMAERIGEGEIVAPVDTKIKEANQVAI
ALSNASFDRSQSEERLQLLLHELVHRSKNILTLVQAMIRQLGRENKSIPEFQKEVDHRLR
GLGMSIRALAEVQWQGLPIRKLIETHLDVFGTVVERFRLEGDDFMLSPEAAQNFGLVVHE
LTTNSIKYGALSVPPGKITVSWKALEKDGRQMLHLVWTETGGPPATEPSRKGFGTTVIKR
HAEGAFGGNVTTEYRETGFEWSLEAPMRYFIPKRTEQTH