Protein Info for Atu4160 in Agrobacterium fabrum C58

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 164 (146 residues), 81.4 bits, see alignment E=2.9e-27 PF04542: Sigma70_r2" amino acids 20 to 82 (63 residues), 53.6 bits, see alignment E=2.4e-18 PF08281: Sigma70_r4_2" amino acids 108 to 160 (53 residues), 60.3 bits, see alignment E=1.7e-20 PF04545: Sigma70_r4" amino acids 113 to 162 (50 residues), 31.1 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 57% identical to ECFG_RHOPT: ECF RNA polymerase sigma factor EcfG (ecfG) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu4160)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG61 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Atu4160 RNA polymerase sigma factor (Agrobacterium fabrum C58)
MAKEPEQTEYNFKREMLAALPNLRAFAISLIRSRDRADDLVQDTIMKAWAKQDSFQPGTN
MRAWLVTILRNEFYSQIRKSGREVQDTDGVYTSRLSVPPEQHGSVDLQDFRTALAKLPDD
QREAILLIGASGFAYEEAAEICGCPVGTIKSRVSRARLRLQELLGIENENEFGPDAQMSA
VTAAATAG