Protein Info for Atu4147 in Agrobacterium fabrum C58

Annotation: glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF02951: GSH-S_N" amino acids 1 to 130 (130 residues), 52.3 bits, see alignment E=8.5e-18 PF08443: RimK" amino acids 133 to 325 (193 residues), 54.2 bits, see alignment E=2.2e-18 PF02955: GSH-S_ATP" amino acids 135 to 314 (180 residues), 191.2 bits, see alignment E=1.6e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4147)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.3

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CU65 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Atu4147 glutathione synthetase (Agrobacterium fabrum C58)
MRIAFFVNSIETEGPTFATGLLAMAALNRGHDVVYLTPGDFTLRSDDTLAVHATVIRKGK
YKKPEAFHAALQDKALERITMDVEEIDALMLRNDPSLDQTTRPWAVHAGILFGRLAEQRG
VVVLNDPEGLALAQNKLYFQSFPEIVRPTTLISRNVEEIRAFADTHPKGVIVKPLQGSGG
KNVFKIGSSKETNLNQIFEAVSLEGYLIAQAYLPAAKEGDVRFFMMNGRPLMRDGQYAAL
RRVPAKGDLRSNIHANGTAEAVKVTDEIVELAEMMRPKLVEDGMFLVGLDIVGDKILEVN
VFSPGGLSNILELTNVDFSDTIIEAVETKVSMQAASGGALSNRLLATL