Protein Info for Atu4142 in Agrobacterium fabrum C58

Annotation: proteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01382: intracellular protease, PfpI family
  • amino acids 8 to 175 (168 residues), 179.5 bits, E=2e-57
• PF01965: DJ-1_PfpI
  • amino acids 8 to 175 (168 residues), 177.4 bits, E=1e-56

Best Hits

Swiss-Prot: 46% identical to YHBO_ECOLI: Protein/nucleic acid deglycase 2 (yhbO) from Escherichia coli (strain K12)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 100% identity to atu:Atu4142)

MetaCyc: 46% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"ThiJ/PfpI family protein"

MetaCyc Pathways

• methylglyoxal degradation IX (1/1 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Sequence Analysis Tools

See A9CG53 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Atu4142 proteinase (Agrobacterium fabrum C58)
MTAINAAKILILATDGYERSELRVPYEQLKARGADVKIASIKEGEIKSWDEKNWGDSIAV
DLSAKTVKVNDFDALVLPGGQINPDILRHDEDAMRVVRDFVKSGKVVAAICHAPWLLIEA
DALRGRDATSYWSIKTDLKNAGANWKDEKVVTDKGIITSRSPDDLDAFVAKIVEEVEEGR
HERRAA