Protein Info for Atu4137 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 117 to 149 (33 residues), see Phobius details PF02308: MgtC" amino acids 27 to 153 (127 residues), 102.2 bits, see alignment E=1.3e-33

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to atu:Atu4137)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG49 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Atu4137 hypothetical protein (Agrobacterium fabrum C58)
MPQSLAEEFSMNISIPFEVLVVRVFGAVILCGLIGLEREFHKNTAGLRTNMLIGLAAVTF
CIITIHMMETMAEGHEAARLDPIRLVEAVTAGIAFLAAGVVVYTRGDVKGLTTGASMWLS
AAIGLSAGLGMWPLALVAASAGIVVLWAIRHLQVAAGIKED