Protein Info for Atu4135 in Agrobacterium fabrum C58

Annotation: glucose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 55 to 71 (17 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details TIGR03074: membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family" amino acids 4 to 778 (775 residues), 1179.4 bits, see alignment E=0 PF13360: PQQ_2" amino acids 215 to 303 (89 residues), 23.6 bits, see alignment E=5.5e-09 amino acids 356 to 502 (147 residues), 23.8 bits, see alignment E=4.9e-09 PF01011: PQQ" amino acids 223 to 251 (29 residues), 23.8 bits, see alignment (E = 4.3e-09) amino acids 283 to 310 (28 residues), 21 bits, see alignment (E = 3.2e-08) amino acids 436 to 462 (27 residues), 24.3 bits, see alignment (E = 3e-09) amino acids 706 to 743 (38 residues), 28.9 bits, see alignment 1e-10

Best Hits

Swiss-Prot: 48% identical to DHG_GLUOX: Quinoprotein glucose dehydrogenase (gdh) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00117, quinoprotein glucose dehydrogenase [EC: 1.1.5.2] (inferred from 100% identity to atu:Atu4135)

Predicted SEED Role

"Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway or Respiratory dehydrogenases 1 (EC 1.1.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG47 at UniProt or InterPro

Protein Sequence (778 amino acids)

>Atu4135 glucose dehydrogenase (Agrobacterium fabrum C58)
MAVTVTAVILTLIGLALFGFGSQLVMLGGSFYYLLSGLAFLLTAVLLFKRNRAALHVYAV
FIVATLAWAVWEVGFDWWQLGPRGGVIILIGLWLLVPWVRKPLGFSSPTGLSYSPNAWPL
VLSVLASFAVAGYSMAQDPHDQAGSLPQEIASAAPVYGGEVPDGDWHQYGRTPYGQRYSP
LTQVNVDNVSQLKEAWRYQTGDVKLPDDVGETTYQVTPLKIGNTLYICTPHNWAIAIDAA
TGKEKWKYDPNVGLNPDRQHQTCRGVSYYAEPNAAAGTACAQRVYLPTSDARLIALDAAT
GQVCTSFADQGVLHLEQGMKYNPAGYYYSTSPPVIAAGKIIIGGAVNDNYSTQEQSGVIR
AFDVNSGALIWNWDSGNPQKTEPIAAGETYTTNSPNSWSVLSYDEGLGLVYVPLGNQVPD
QLGMGRSENVEKYSSSIVALDINTGKDRWVRQTVHHDLWDMDVPAQPVLLDITKDGQTVP
ALVGPTKQGDIYVLDRRTGEPLLPITEEPAPTGAIPEDFTSPTQPTSALSFKPEPLQEKN
MWGVSMFDQLACRIRFHQLNYKGRYTPPSLNGSIIYPGNFGTFNWGSVAVDPERQVMFGM
PTYLAFTSQLVPRADIPPKGQDEKGSEQGLNRNDGAPYGVFMGPFLGPLKIPCQAPPWGY
VAGADLRTGDVAYKHKNGTVYDMTPLPLPFKVGVPGIGGPMITKGGVAFLGAAVDNYLRA
YDLTTGKELWEARLPAGGQATPMTYSLENGKQYVVMVAGGHGSVGTKPGDYVIAYTLP