Protein Info for Atu4129 in Agrobacterium fabrum C58

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF07991: KARI_N" amino acids 2 to 78 (77 residues), 22.2 bits, see alignment E=1.9e-08 PF03446: NAD_binding_2" amino acids 3 to 159 (157 residues), 161.7 bits, see alignment E=3.2e-51 PF03807: F420_oxidored" amino acids 3 to 92 (90 residues), 33.6 bits, see alignment E=1e-11 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 6 to 290 (285 residues), 408.6 bits, see alignment E=7.2e-127 PF14833: NAD_binding_11" amino acids 162 to 289 (128 residues), 119.2 bits, see alignment E=2.7e-38

Best Hits

Swiss-Prot: 54% identical to MMSB_MYCBO: Probable 3-hydroxyisobutyrate dehydrogenase (mmsB) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 100% identity to atu:Atu4129)

MetaCyc: 49% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG44 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu4129 3-hydroxyisobutyrate dehydrogenase (Agrobacterium fabrum C58)
MKTVAFLGLGHMGLPMAANLVKAGYAVRGFDLSEACRTAAREAGIPVAADATEATHAADV
VITMLPKGEHVVSVYGDLVRKVSAGTLLIDCSTVDMESALKAHELAASAGCPSVDAPVSG
GTSGAAAGTLTFMCGGEPDAFSAARPVLEAMGKKIVHCGKGGNGQAAKICNNMILGISMI
AVSEAFVLGEKLGLSHQALFDVASTSSGQCWSLTTYCPVPGPVPTSPANKDYQPGFAAAL
MLKDLKLSQAAANGTGVSTPLGAAASALYESFVGEGGGGRDFSAIVEMLRGGEA