Protein Info for Atu4127 in Agrobacterium fabrum C58

Annotation: branched chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 261 to 285 (25 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 310 (262 residues), 137.5 bits, see alignment E=2.5e-44

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu4127)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG42 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Atu4127 branched chain amino acid ABC transporter permease (Agrobacterium fabrum C58)
MSKATHSPTAGAMPQTEVSTTAGTIKTVLILAGLAVLIAAPMFVYPIFLMKLLCFALFAC
AFNLLIGYTGLLSFGHAAFFGGAAYFTAYSVKEWGVTPEIGLIIGMAGAALLGLVIGFFA
IRRQGIYFAMITLALSQMFYFFCLQAPFTHGEDGLQGVPRGHLFGLLDLNAPLNIYYTVL
AAFVLALLVIWRFVNSPFGMILKSIRENEQRAISLGYSVQRYKLGAFVMSAALAGLAGGL
KALVFQFATLTDVTWQMSGEVILMTLLGGIGTMIGPIFGAGLVVTLQNYLATSDFPVTII
TGLVFMACVLVFRRGLIGEFYASRLGRKLGFQHRG