Protein Info for Atu4126 in Agrobacterium fabrum C58

Annotation: branched chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 192 to 219 (28 residues), see Phobius details amino acids 230 to 257 (28 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 283 (267 residues), 139 bits, see alignment E=8.6e-45

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu4126)

Predicted SEED Role

"ABC branched-chain amino acid transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG41 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Atu4126 branched chain amino acid ABC transporter permease (Agrobacterium fabrum C58)
MTMIFGIPIQALLGQLLIGLINGSFYALLSLGLAVIFGLLRVINFAHGAQYMLGAFVAFL
GLQYFGINFWMALIVTPLVVALFGAIVERFMLSRLYDLDPLYGLLFTFGLALVVEGTFRW
LYGAAGQPYSVPRELAGGTNLGFMFLPNYRAFVVVISLVACIATWALIEKTRLGSYLRAA
TENPTLVQAFGINVPVLLTLTYALGAGLAGFTGVLAAPIYQVSPLMGTNLIIVVFAVVVV
GGMGSIMGAIVTGYMLGIAEGLTKVFYPEASNIVIFVIMAFVLLIRPAGLFGKDA