Protein Info for Atu4116 in Agrobacterium fabrum C58

Annotation: dipeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00005: ABC_tran" amino acids 24 to 182 (159 residues), 96.6 bits, see alignment E=3e-31 PF08352: oligo_HPY" amino acids 233 to 266 (34 residues), 31.2 bits, see alignment 3.7e-11

Best Hits

Swiss-Prot: 49% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K12371, dipeptide transport system ATP-binding protein (inferred from 100% identity to atu:Atu4116)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG34 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Atu4116 dipeptide ABC transporter ATPase (Agrobacterium fabrum C58)
MSLLKIKNLTVKFATATGAFTAVDGIDVSVDKHEVLAIVGESGSGKSVSMLAVMGLLPDT
ATITADEMTFDGKNLLNMSSQERRRVIGREITMIFQEPVASLNPSFTVGFQIEEVLRLNL
GMSGAAARARALELFQAVGIPEPETKLKAYPHQMSGGQCQRVMIAIAIASKPRLLIADEP
TTALDVTIQKQILDLLMKLQEEYGMALILITHDMGVVAETADRVVVQYKGRKMEEADVLS
LFEAPQHPYTKALLSALPENATGDRLPTVSDFFGKEGVR