Protein Info for Atu4104 in Agrobacterium fabrum C58

Annotation: 30S ribosomal protein S1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 TIGR00717: ribosomal protein bS1" amino acids 10 to 530 (521 residues), 625.6 bits, see alignment E=3.2e-192 PF00575: S1" amino acids 25 to 92 (68 residues), 53.7 bits, see alignment E=4.5e-18 amino acids 107 to 177 (71 residues), 56.7 bits, see alignment E=5.2e-19 amino acids 195 to 266 (72 residues), 73.9 bits, see alignment E=2.2e-24 amino acids 280 to 353 (74 residues), 74.4 bits, see alignment E=1.5e-24 amino acids 367 to 440 (74 residues), 66.5 bits, see alignment E=4.4e-22 amino acids 456 to 530 (75 residues), 37.9 bits, see alignment E=3.9e-13 PF23459: S1_RRP5" amino acids 195 to 259 (65 residues), 27.8 bits, see alignment E=6e-10 amino acids 283 to 350 (68 residues), 30.5 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 94% identical to RS1_RHIME: 30S ribosomal protein S1 (rpsA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to atu:Atu4104)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CU26 at UniProt or InterPro

Protein Sequence (566 amino acids)

>Atu4104 30S ribosomal protein S1 (Agrobacterium fabrum C58)
MSVSTPTRDDFAALLEESFASNDLAEGYVAKGIVTAIEKDVAIVDVGLKVEGRVPLKEFG
AKSKDGTLKVGDEVEVYVERIENALGEAVLSREKARREESWVKLEAKFEAGERVEGVIFN
QVKGGFTVDLDGAVAFLPRSQVDIRPIRDVTPLMHNPQPFEILKMDKRRGNIVVSRRTVL
EESRAEQRSEIVQNLEEGQVVDGVVKNITDYGAFVDLGGIDGLLHVTDMAWRRVNHPSEI
LNIGQQVKVQIIRINQETHRISLGMKQLESDPWDGISAKYPVGKKISGTVTNITDYGAFV
ELEPGIEGLIHISEMSWTKKNVHPGKILSTSQEVDVVVLEVDPSKRRISLGLKQTLENPW
QAFAFSHPAGTEVEGEVKNKTEFGLFIGLEGDVDGMVHLSDLDWNRPGEQVIEEFNKGDV
VKAVVLDVDVEKERISLGIKQLGKDAVGEAATSGDLRKNAVVSCEVIAVNDGGVEVKLVN
HEDITSFIRRNDLARDRDDQRPERFAVGQVFDARVVNFSKKDRKVMLSIKALEIAEEKEA
VAQFGSSDSGASLGDILGAALKNRGE