Protein Info for Atu4089 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 91 to 115 (25 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 2 to 499 (498 residues), 551.3 bits, see alignment E=1.4e-169 PF00664: ABC_membrane" amino acids 9 to 220 (212 residues), 59.2 bits, see alignment E=8.3e-20 PF00005: ABC_tran" amino acids 311 to 457 (147 residues), 93.9 bits, see alignment E=2e-30

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to atu:Atu4089)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CU16 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Atu4089 ABC transporter permease (Agrobacterium fabrum C58)
MMAIVPAAVAVLILGLLKAWLEKVAARLSFRAARAALSQRRFEALQAVAKVSPLDLSRTA
SGEAAGIVAEAAEALVPYLSRFQPARMKATIVPLVFVLAILPFSWIAALVLLLAMPTIPL
FMALIGWQAKAASEKQLAETGNINAFLLDRLRGLETIRTLKAVDLTAARLDADAQNLKKR
TMAVLRIAFLSSAVLELFAAIGVAMTAVYIGFHLLGFLDFGAWGEKLTLAEGLFILLLAP
AFFEPLRELSAVWHDRAAGEASLNALATLTAGGAAIVGEGADVVRAPSSTPGLLEMENLS
FAYPNAPPVIRNFNLTVQQGERVAILGASGCGKSTILSLIAGLAEAGEGVIRIGGVTLDD
ATADGLRGTIGWVSQKPFFFAASMKANIGFGRLAVSEAMVEEVLHRTGLDGLTQARRHLQ
IGDGGNGISGGEAVRLAIARAFADPATQLVLADEPTAHLDRETAALVTDNLLQLAKGRTL
IVATHDPVLAARMDRIVDMTAIHSRGQP