Protein Info for Atu4074 in Agrobacterium fabrum C58

Annotation: phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 13 to 152 (140 residues), 119.5 bits, E=1.8e-38
• PF02879: PGM_PMM_II
  • amino acids 183 to 285 (103 residues), 52.2 bits, E=1.6e-17
• PF02880: PGM_PMM_III
  • amino acids 294 to 406 (113 residues), 87.6 bits, E=1.3e-28
• PF00408: PGM_PMM_IV
  • amino acids 460 to 507 (48 residues), 23.7 bits, 8.5e-09

Best Hits

Swiss-Prot: 100% identical to PGM_RHIRD: Phosphoglucomutase (pgm) from Rhizobium radiobacter

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to atu:Atu4074)

MetaCyc: 57% identical to phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (Arabidopsis thaliana col)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• chitin biosynthesis (5/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See Q7CU06 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Atu4074 phosphoglucomutase (Agrobacterium fabrum C58)
MIKTIKTTPYQDQKPGTSGLRKKVPVFAQENYAENFIQSIFDALEGFEGQTLVIGGDGRY
YNREVIQKAIKMAAAAGFGKVLVGQGGILSTPAASNVIRKYKAFGGIVLSASHNPGGPTE
DFGIKYNIGNGGPAPEKITDAIYARSKVIDSYKISDAADIDLDKIGSFKVDELTVDVIDP
VADYAALMEELFDFGAIRSLIAGGFKVVVDSMSAVTGPYAVEILEKRLGAPKGSVRNATP
LPDFGGHHPDPNLVHAKELYDDVMSPEGPDFGAASDGDGDRNMVVGKGMFVTPSDSLAII
AANAKLAPGYAAGISGIARSMPTSAAADRVAEKLGLGMYETPTGWKFFGNLMDAGKVTIC
GEESFGTGSNHVREKDGLWAVLYWLNIVAARKESVKDIVTKHWAEYGRNYYSRHDYEEVD
SDAANTLVAILREKLATLPGTSYGNLKVAAADDFAYHDPVDQSVSKNQGIRILFEGGSRI
VLRLSGTGTAGATLRLYVERYEPDAARHGIETQSALADLISVADTIAGIKAHTGRSEPTV
IT