Protein Info for Atu4055 in Agrobacterium fabrum C58

Annotation: endo-1,3-1,4-beta-glycanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF06439: 3keto-disac_hyd" amino acids 53 to 210 (158 residues), 29.5 bits, see alignment E=7.7e-11 PF00722: Glyco_hydro_16" amino acids 59 to 232 (174 residues), 143.9 bits, see alignment E=3.6e-46

Best Hits

Swiss-Prot: 70% identical to EXOK_RHIME: Endo-1,3-1,4-beta-glycanase ExoK (exoK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4055)

Predicted SEED Role

"Endo-beta-1,3-1,4 glucanase (Licheninase) (EC 3.2.1.73)" in subsystem Beta-Glucoside Metabolism (EC 3.2.1.73)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.73

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTY9 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Atu4055 endo-1,3-1,4-beta-glycanase (Agrobacterium fabrum C58)
MTTFVTRVQTRIFLAAALSITAFAAPIHAQEDNGTSFIENFDQMDRSFWYVSDGWNNGAH
QNCTWSKKLATVENGQLTLGFEEAKAGERNFACGEIQTKGRYRYGTYEARMKAATGSGLN
SAFFTYIGPTDKKPHDEIDFEVLGKNTGKVQLNQYIAAKGGNEKLVPVEGGADAGFNDYA
FVWEPQRLRYYVNGKLVHEVTDETKIPQNAQKIFFSLWGTDTLKDWMGKFSYTGATQMIV
DRFAFTALGDKCQFPESIACALN