Protein Info for Atu4047 in Agrobacterium fabrum C58

Annotation: two component sensor kinase/response regulator hybrid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 991 TIGR00229: PAS domain S-box protein" amino acids 172 to 290 (119 residues), 49.9 bits, see alignment E=1.7e-17 amino acids 293 to 414 (122 residues), 50.1 bits, see alignment E=1.5e-17 PF13596: PAS_10" amino acids 173 to 280 (108 residues), 24.6 bits, see alignment E=1.3e-08 PF08448: PAS_4" amino acids 177 to 285 (109 residues), 74.9 bits, see alignment E=2.3e-24 amino acids 312 to 411 (100 residues), 35.2 bits, see alignment E=5e-12 PF13426: PAS_9" amino acids 183 to 282 (100 residues), 28.9 bits, see alignment E=4.6e-10 amino acids 322 to 408 (87 residues), 21.3 bits, see alignment E=1.1e-07 PF00989: PAS" amino acids 296 to 406 (111 residues), 23.3 bits, see alignment E=2.2e-08 PF08447: PAS_3" amino acids 322 to 403 (82 residues), 62.1 bits, see alignment E=2e-20 PF00512: HisKA" amino acids 472 to 535 (64 residues), 28.4 bits, see alignment 5.4e-10 PF02518: HATPase_c" amino acids 578 to 698 (121 residues), 70.2 bits, see alignment E=8.3e-23 PF00072: Response_reg" amino acids 721 to 832 (112 residues), 44.5 bits, see alignment E=6.5e-15 amino acids 874 to 979 (106 residues), 58.6 bits, see alignment E=2.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4047)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTY1 at UniProt or InterPro

Protein Sequence (991 amino acids)

>Atu4047 two component sensor kinase/response regulator hybrid (Agrobacterium fabrum C58)
MTNLRAAPVWPIGGGETGELVRRFDWSKTSLGPICDWPQNLRQKANSVVNSPIPQVLMWG
SDHVMIYNDGYAEIAGNYHPRALGGTVPGIWPEIWDWNSRILEAGFRGEVMAYRDQPMTL
MRHGVPEEVIFDLFYTPIYNEGGTVDGVLCTVLENTDKVRALEALEQSRMELSRLTNALP
ILVGYVDRDYVYRFANDGYLEWFGRRAEEVIGRSVPDIVGAAFFEARRTYLDRALAGEKI
VSDTVIRRPDGSLRAAEISYVPRYISDGSIDGIYVLIIDIEERKRSEQEILISNNRFRAA
VEAVHGVLWTNSADGRMRGEQPAWTAMTGQTPEEYQDFGWADAVHPEDRQGSVDSWNRAV
AEKSTYLWEHRVRRHDGVYRTFSIRGVPIFDKDGAIAEWVGVHTDITEQRQSEDTLKEHA
SNLEREIRHRIRAEEQLRQLNEGLEARVEMEMAERRQTEKALQQAQKMESIGQLTGGVAH
DFNNLLQVIAGNLQLLSKDVIGNERAERRLENALAGVHRGAKLASQLLAFGRRQALEPRV
INIARFVTGMDDLLRRSLGEGIEVEVITSGGLWNTYADPNQVENALLNLAINARDAMEGH
GKLTIEVGNAVLDRDYARKHSEVSAGQYVMLAVTDTGSGMSPEILEKVFEPFFSTKPEGK
GTGLGLSMVYGFAKQSSGHVNIYSEVGQGTTVKMYLPRSAADEDREVVMPTGPVEGGTET
ILVVEDDEEVRNTVVETLGDLGYRVLTARDAQAGLTVVESGIPIDVIFTDVVMPGSLKSR
EMARRAQERLPNLAVLFTSGYTENSIVHGGKLDAGVELLSKPYTREALARRLRHVIANRK
QVSLSRAQPAATNGYSKLSQTASAVDSENRSIRVLLVEDDELIRMNSTEMLSDSGFAVVE
AGNAAQALEVIEADPIDVLVTDLGLPDMKGGELAAEALRRKPGLAIVFATGDSHLPEGAP
ESAVLLTKPYDEQQIVAAVERAHTAKATGAE