Protein Info for Atu4045 in Agrobacterium fabrum C58

Annotation: glycine betaine ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details amino acids 214 to 241 (28 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 282 (165 residues), 99.5 bits, see alignment E=1e-32

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to atu:Atu4045)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTX9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Atu4045 glycine betaine ABC transporter permease (Agrobacterium fabrum C58)
MEWLFKFPTMNDDALRALKKVIDEGFRGFTRTYGGAIEGLFTPLQSFLIWAERLLIGAPW
PVVILIVGALAWFASRSATIVSLCCGILFAIGWFGMWEDTMKTVSMIFVCAVMSIVIGLP
IGIAMARSNRLQNVVNPVLDVMQTMPSFVYLIPVVMLLGIGRVPGVIAVIIYAIPPMIRL
TNLGIRMVDHDVLEAADAFGSSKRQKLFKVQLPLALPTIMAGINQTIMMALAMVVIASMI
GVQGLGQPVLKAIANQYFTLGVFNGLAIVGIAIIFDRISQAYGLRLQKHREVAHG