Protein Info for Atu4022 in Agrobacterium fabrum C58

Annotation: hydroxamate-type ferrisiderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07715: Plug" amino acids 74 to 174 (101 residues), 86.8 bits, see alignment E=1.4e-28 TIGR01783: TonB-dependent siderophore receptor" amino acids 76 to 708 (633 residues), 426.7 bits, see alignment E=9.1e-132 PF00593: TonB_dep_Rec_b-barrel" amino acids 247 to 680 (434 residues), 231.9 bits, see alignment E=2.8e-72

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to atu:Atu4022)

Predicted SEED Role

"Ferric hydroxamate outer membrane receptor FhuA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTV9 at UniProt or InterPro

Protein Sequence (710 amino acids)

>Atu4022 hydroxamate-type ferrisiderophore receptor (Agrobacterium fabrum C58)
MQGKSKHISILAGGCAAIAYVAFLAPAAALAQEAGTTLLQTITVEGAKNQDPKAPVKGYV
AKTSASATKTGRSLVETPQSVSVITKDQMDAQTVRNLSEALNYVPGVVAQPSGADPRFDA
PRIRGFQGNQLQFLNGLRLMRTAGAPPYEVYGLERVEVIRGPASVLYGQGNPGGLINLVS
KRPTFERFGEVGAQIGSFDYYQSMFDIGGPVAGTDSFAYRLTGLARKAHTQTDNLQNDRY
FIAPALTWQPDEDTKLTVLASYQHDNPSSPSGLPPALTYSRPGNMLDRSFYVGDPSFDTS
NRKFTNIGYEFEHRFDETFTFRQNARYSNFDWSYRALGMSSTSGGMIGNLIRRNATFQDE
LLNTFNIDNSLQADFSTGPIDHTLLVGLDYRYFDNNVKTEFWAATPLNPVNPVYGGPISL
TSRTLYADVKTDISQIGFYAQDEMAIENWRITAGLRQDWASTSGTTFNGTTYRTLDKDDH
KLTGRVGVSYLFDGGFAPYVSYATSFEPVPQPAVGDAPKPTTGEQWEAGIKYQPEGFDGF
FSAAIYDLKQKNVTTTVGGVTQQMDEARVKGLELEGVASLTDGLDLRAAYTYMDSEVSGR
VNDGKELDSTPRHAASLWLDYTFAEDTALEGFGIGGGVRYVGKRYGDAANTFEMKGLALL
DLGVHYEKNGYRASLQVQNLTDKEYISSCSTFGCYYGDGRTVMGKLTYRW