Protein Info for Atu4001 in Agrobacterium fabrum C58

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF08545: ACP_syn_III" amino acids 109 to 187 (79 residues), 74.8 bits, see alignment E=4e-25 PF08541: ACP_syn_III_C" amino acids 239 to 327 (89 residues), 91.2 bits, see alignment E=3.9e-30

Best Hits

Swiss-Prot: 42% identical to FABH_DESAG: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to atu:Atu4001)

MetaCyc: 100% identical to 3-oxoacyl-(acyl-carrier-protein) synthase III (Agrobacterium fabrum C58)
RXN-22027

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTU0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Atu4001 3-oxoacyl-ACP synthase (Agrobacterium fabrum C58)
MQTRSSRMAGFGHAVPARCVDNAEIEASLGLEAGWIERRTGIRSRYWAEAGDTLSGLAER
AGRMALEDAKINADDIALTLLATSTPDHLLPPSAPLLAHRLGLTRSGAIDLAGACSGFLY
ALTLADGFVRTYGRAVLVVAANILSRRINPAERASAVLFADAAGAVVLTPCPEVKRGVLS
ADLVADGSGYDLIQIAAGGSSQPFSAGMIAEDALMTMRDGREVFSRAVALMTNTSQRVLH
EAELTAADISRFVPHQANARMSDAVCGNLGIEREKTVRTIGSFGNSSAATIPLSLSITNA
ERPLAGGETLLLTAAGAGMTGGAVVYRV